(data stored in ACNUC7421 zone)

EMBL: CP001509.PE508

CP001509.PE508       Location/Qualifiers
FT   CDS             550550..551146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_00513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00513"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42409"
FT                   /protein_id="ACT42409.1"
FT                   /translation="MAVQISGVLKDGAGKPIQNCTIQLKAKRNSTTVLVNTVASENPDE
FT                   AGRYSMDVEHGQYSVTLLVEGFPPSHAGTITVYEGSRPGTLNDFLGAMTEDDVMPEALR
FT                   RFEAMVEEAARNAEAASQSAAAAKKSETAAASSKNAAKTSETNAATASGFCRSPRVQTR
FT                   SPRLSPGAVLHRPAISSGRPFCPAPAQIQGRETAG"
     MAVQISGVLK DGAGKPIQNC TIQLKAKRNS TTVLVNTVAS ENPDEAGRYS MDVEHGQYSV        60
     TLLVEGFPPS HAGTITVYEG SRPGTLNDFL GAMTEDDVMP EALRRFEAMV EEAARNAEAA       120
     SQSAAAAKKS ETAAASSKNA AKTSETNAAT ASGFCRSPRV QTRSPRLSPG AVLHRPAISS       180
     GRPFCPAPAQ IQGRETAG                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page