(data stored in ACNUC7421 zone)

EMBL: CP001509.PE509

CP001509.PE509       Location/Qualifiers
FT   CDS             complement(550995..551267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_00530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00530"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42410"
FT                   /protein_id="ACT42410.1"
FT                   /translation="MSTGLRFTLEVDGLPPDAFAVVSFHLNQSLSSLFSLDLSLVSQQF
FT                   LSLEFAQVLDKMAYLTIWQGDEVQRRVKGVVTWFELGENDKNQML"
     MSTGLRFTLE VDGLPPDAFA VVSFHLNQSL SSLFSLDLSL VSQQFLSLEF AQVLDKMAYL        60
     TIWQGDEVQR RVKGVVTWFE LGENDKNQML                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page