(data stored in ACNUC7421 zone)

EMBL: CP001509.PE599

CP001509.PE599       Location/Qualifiers
FT   CDS             647213..649090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_00624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00624"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42500"
FT                   /protein_id="ACT42500.1"
FT                   /translation="MSASSVKPLNVQLPAITLILFALCVGIFCYLAQWMSYEEVDQSAL
FT                   IHLGANVASLSLSGEPWRLLSSVFLHSSFSHLLMNMFALLVVGAVTERILGKWRLLIIW
FT                   LFSGVFGGLISACYALRDSDQIVISVGASGAIMGIAGAAIATQLASGTGTHHKNQRRVF
FT                   PLLGMVALTLLYGARQTGIDNACHIGGLIAGGALGWLSARLSGQNRLVTEGGIIVAGSL
FT                   LLTGAIWLAQQQMDESVLQVRQSLREEFYPQEIEQERRQKKQQLAEERNALRETLSAPV
FT                   SREQASGDLLAEIADIHDMAISRDGNTLYAAIENTNSIVVFDLGQKKILHTFTAPIAKE
FT                   KSVKHCGGCKDQGVRSLTLSPDETLLYATSFEANALSVINVATGEIIQSITTGAHPDSL
FT                   ILSRDGTKAWVMNRTSNSVSAIDLVAYQHVADIPLEKYDGTGTSNKPGAWVMALSPDEK
FT                   ILLIPGMVRGDIVRINTITHQKEDFPAGDARGTISAMRFRPENGDVIFADSQGISRIRV
FT                   GDQQASIMTQWCSRSVYSVEGISPDGQYLALVSYGLQGYVILLNINVGQIVGVYPASYV
FT                   NHLRFSADGRKIFVMAKNGLIQMDRTLSLDPQAVIRHPQYGNVACIPEP"
     MSASSVKPLN VQLPAITLIL FALCVGIFCY LAQWMSYEEV DQSALIHLGA NVASLSLSGE        60
     PWRLLSSVFL HSSFSHLLMN MFALLVVGAV TERILGKWRL LIIWLFSGVF GGLISACYAL       120
     RDSDQIVISV GASGAIMGIA GAAIATQLAS GTGTHHKNQR RVFPLLGMVA LTLLYGARQT       180
     GIDNACHIGG LIAGGALGWL SARLSGQNRL VTEGGIIVAG SLLLTGAIWL AQQQMDESVL       240
     QVRQSLREEF YPQEIEQERR QKKQQLAEER NALRETLSAP VSREQASGDL LAEIADIHDM       300
     AISRDGNTLY AAIENTNSIV VFDLGQKKIL HTFTAPIAKE KSVKHCGGCK DQGVRSLTLS       360
     PDETLLYATS FEANALSVIN VATGEIIQSI TTGAHPDSLI LSRDGTKAWV MNRTSNSVSA       420
     IDLVAYQHVA DIPLEKYDGT GTSNKPGAWV MALSPDEKIL LIPGMVRGDI VRINTITHQK       480
     EDFPAGDARG TISAMRFRPE NGDVIFADSQ GISRIRVGDQ QASIMTQWCS RSVYSVEGIS       540
     PDGQYLALVS YGLQGYVILL NINVGQIVGV YPASYVNHLR FSADGRKIFV MAKNGLIQMD       600
     RTLSLDPQAV IRHPQYGNVA CIPEP                                             625
//

If you have problems or comments...

PBIL Back to PBIL home page