(data stored in ACNUC7421 zone)

EMBL: CP001509.PE637

CP001509.PE637       Location/Qualifiers
FT   CDS             693938..694213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_00662"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00662"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42538"
FT                   /protein_id="ACT42538.1"
FT                   /translation="MILFTISHSVFGKENPVEILVNSREMALELSYVYIKYVYGKEKAE
FT                   FQKPYSITDDNNCWKIEGKQPKTLGGNFTILIAKKDGQVLHVIHTK"
     MILFTISHSV FGKENPVEIL VNSREMALEL SYVYIKYVYG KEKAEFQKPY SITDDNNCWK        60
     IEGKQPKTLG GNFTILIAKK DGQVLHVIHT K                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page