(data stored in ACNUC7421 zone)

EMBL: CP001509.PE638

CP001509.PE638       Location/Qualifiers
FT   CDS             complement(694425..694703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_00663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00663"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42539"
FT                   /protein_id="ACT42539.1"
FT                   /translation="MLPVFRYGGAGSHKGKKFPAVRRPIVHDGNAPASIGYRSDNRVTC
FT                   RRIAYLMFILFHKPSVHIVIVKIQYIFADAVIQLHVGSAEYCSRYGQ"
     MLPVFRYGGA GSHKGKKFPA VRRPIVHDGN APASIGYRSD NRVTCRRIAY LMFILFHKPS        60
     VHIVIVKIQY IFADAVIQLH VGSAEYCSRY GQ                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page