(data stored in ACNUC7421 zone)

EMBL: CP001509.PE639

CP001509.PE639       Location/Qualifiers
FT   CDS             694922..695164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_00664"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00664"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42540"
FT                   /protein_id="ACT42540.1"
FT                   /translation="MVFSDVSFFNITPNGSIPDDYIISIITDNVNVEYFESTIVAVGQI
FT                   PNTNSGDIDNIGECQIFIRYKHSWIENKFKEKIIE"
     MVFSDVSFFN ITPNGSIPDD YIISIITDNV NVEYFESTIV AVGQIPNTNS GDIDNIGECQ        60
     IFIRYKHSWI ENKFKEKIIE                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page