(data stored in ACNUC7421 zone)

EMBL: CP001509.PE692

CP001509.PE692       Location/Qualifiers
FT   CDS             complement(756290..756472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_10011"
FT                   /product="hypothetical protein"
FT                   /note="similar to lambdap39; orf60a"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10011"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42593"
FT                   /protein_id="ACT42593.1"
FT                   /translation="MTHPHDNIRVGAITFVYSVTKRGWVFPGLSVIRNPLKAQRLAEEI
FT                   NNKRGAVCTKHLLLS"
     MTHPHDNIRV GAITFVYSVT KRGWVFPGLS VIRNPLKAQR LAEEINNKRG AVCTKHLLLS        60
//

If you have problems or comments...

PBIL Back to PBIL home page