(data stored in ACNUC7421 zone)

EMBL: CP001509.PE709

CP001509.PE709       Location/Qualifiers
FT   CDS             764594..764788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_10028"
FT                   /product="hypothetical protein"
FT                   /note="similar to lambdap73; orf-64"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10028"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42610"
FT                   /protein_id="ACT42610.1"
FT                   /translation="MKRGGAYYRFRLVGHFDVSSGTPTIAGREVCKMQSRNSSQVIVRA
FT                   CITVSGFFISAQQVRALSR"
     MKRGGAYYRF RLVGHFDVSS GTPTIAGREV CKMQSRNSSQ VIVRACITVS GFFISAQQVR        60
     ALSR                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page