(data stored in ACNUC7421 zone)

EMBL: CP001509.PE713

CP001509.PE713       Location/Qualifiers
FT   CDS             complement(766432..766725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_10032"
FT                   /product="Bor protein precursor"
FT                   /note="similar to lambdap77"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10032"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42614"
FT                   /protein_id="ACT42614.1"
FT                   /translation="MKKMLLATALALLITGCAQQTFTVQNKPAAVAPKETITHHFFVSG
FT                   IGQKKTVDAAKICGGAENVVKTETQQTFVNGLLGFITLGIYTPLEARVYCSK"
     MKKMLLATAL ALLITGCAQQ TFTVQNKPAA VAPKETITHH FFVSGIGQKK TVDAAKICGG        60
     AENVVKTETQ QTFVNGLLGF ITLGIYTPLE ARVYCSK                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page