(data stored in ACNUC7421 zone)

EMBL: CP001509.PE714

CP001509.PE714       Location/Qualifiers
FT   CDS             complement(767015..767548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_10033"
FT                   /product="putative envelope protein"
FT                   /note="similar to lambdap78"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10033"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42615"
FT                   /protein_id="ACT42615.1"
FT                   /translation="MKTFLIFDINHQQNTRRSDQIETIKTIMQTTRPRITWKVLPMAQV
FT                   AIFKEIFDQVRKDLDCELFYSELKRHNVSHYIYYLATDNIHIVLENDNTVLIKGLKKVV
FT                   NVKFSRNTHLIETSYDRLKSREITFQQYRENLAKAGVFRWVTNIHEHKRYYYTFDNSLL
FT                   FTESIQNTTQIFPR"
     MKTFLIFDIN HQQNTRRSDQ IETIKTIMQT TRPRITWKVL PMAQVAIFKE IFDQVRKDLD        60
     CELFYSELKR HNVSHYIYYL ATDNIHIVLE NDNTVLIKGL KKVVNVKFSR NTHLIETSYD       120
     RLKSREITFQ QYRENLAKAG VFRWVTNIHE HKRYYYTFDN SLLFTESIQN TTQIFPR          177
//

If you have problems or comments...

PBIL Back to PBIL home page