(data stored in ACNUC7421 zone)

EMBL: CP001509.PE715

CP001509.PE715       Location/Qualifiers
FT   CDS             767711..767917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_10034"
FT                   /product="hypothetical protein"
FT                   /note="similar to lambdap79"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10034"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42616"
FT                   /protein_id="ACT42616.1"
FT                   /translation="MNKEQSADDPSVDLIRVKNMLNSTISMSYPDVVIACIEHKVSLEA
FT                   FRAIEAALVKHDNNMKDYSLVVD"
     MNKEQSADDP SVDLIRVKNM LNSTISMSYP DVVIACIEHK VSLEAFRAIE AALVKHDNNM        60
     KDYSLVVD                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page