(data stored in ACNUC7421 zone)

EMBL: CP001509.PE737

CP001509.PE737       Location/Qualifiers
FT   CDS             788125..789330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_10056"
FT                   /product="Tail fiber protein"
FT                   /note="similar to lambdap27; orf-401"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10056"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42638"
FT                   /protein_id="ACT42638.1"
FT                   /translation="MAVKISGVLKDGTGKPVQNCTIQLKARRNSTTVVVNTVGSENPDE
FT                   AGRYSMDVEYGQYSVILQVDGFPPSHAGTITVYEDSQPGTLNDFLCAMTEDDARPEVLR
FT                   RLELMVEEVARNASVVAQSTADAKKSAGDASASAAQVAALVTDATDSARAASTSAGQAA
FT                   SSAQEASSGAEAASAKATEAEKSAAAAESSKNAAATSAGAAKTSETNAAASQQSAATSA
FT                   STAATKASEAATSARDAVASKEAAKSSETNASSSAGRAASSATAAENSARAAKTSETNA
FT                   RSSETAAERSASAAADAKTAAAGSASTASTKATEAAGSAVSASQSKSAAEAAAIRAENS
FT                   AKRAEDIASAVALEDADTTRKGIVQLSSATNSTSETLAATPKAVKVVMDETNRKAHWTV
FT                   RH"
     MAVKISGVLK DGTGKPVQNC TIQLKARRNS TTVVVNTVGS ENPDEAGRYS MDVEYGQYSV        60
     ILQVDGFPPS HAGTITVYED SQPGTLNDFL CAMTEDDARP EVLRRLELMV EEVARNASVV       120
     AQSTADAKKS AGDASASAAQ VAALVTDATD SARAASTSAG QAASSAQEAS SGAEAASAKA       180
     TEAEKSAAAA ESSKNAAATS AGAAKTSETN AAASQQSAAT SASTAATKAS EAATSARDAV       240
     ASKEAAKSSE TNASSSAGRA ASSATAAENS ARAAKTSETN ARSSETAAER SASAAADAKT       300
     AAAGSASTAS TKATEAAGSA VSASQSKSAA EAAAIRAENS AKRAEDIASA VALEDADTTR       360
     KGIVQLSSAT NSTSETLAAT PKAVKVVMDE TNRKAHWTVR H                           401
//

If you have problems or comments...

PBIL Back to PBIL home page