(data stored in ACNUC7421 zone)

EMBL: CP001509.PHOE

CP001509.PHOE        Location/Qualifiers
FT   CDS             complement(263558..264595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoE"
FT                   /locus_tag="ECD_00238"
FT                   /product="outer membrane phosphoporin protein E"
FT                   /note="similar to b0241"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00238"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42137"
FT                   /protein_id="ACT42137.1"
FT                   /translation="MKKSTLALVVMGIVASASVQAAEIYNKDGNKLDVYGKVKAMHYMS
FT                   DNDSKDGDQSYIRFGFKGETQINDQLTGYGRWEAEFAGNKAESDTAQQKTRLAFAGLKY
FT                   KDLGSFDYGRNLGALYDVEAWTDMFPEFGGDSSAQTDNFMTKRASGLATYRNTDFFGVI
FT                   DGLNLTLQYQGKNENRDVKKQNGDGFGTSLTYDFGGSDFAISGAYTNSDRTNEQNLQSR
FT                   GTGKRAEAWATGLKYDANNIYLATFYSETRKMTPITGGFANKTQNFEAVAQYQFDFGLR
FT                   PSLGYVLSKGKDIEGIGDEDLVNYIDVGATYYFNKNMSAFVDYKINQLDSDNKLNINND
FT                   DIVAG"
     MKKSTLALVV MGIVASASVQ AAEIYNKDGN KLDVYGKVKA MHYMSDNDSK DGDQSYIRFG        60
     FKGETQINDQ LTGYGRWEAE FAGNKAESDT AQQKTRLAFA GLKYKDLGSF DYGRNLGALY       120
     DVEAWTDMFP EFGGDSSAQT DNFMTKRASG LATYRNTDFF GVIDGLNLTL QYQGKNENRD       180
     VKKQNGDGFG TSLTYDFGGS DFAISGAYTN SDRTNEQNLQ SRGTGKRAEA WATGLKYDAN       240
     NIYLATFYSE TRKMTPITGG FANKTQNFEA VAQYQFDFGL RPSLGYVLSK GKDIEGIGDE       300
     DLVNYIDVGA TYYFNKNMSA FVDYKINQLD SDNKLNINND DIVAG                       345
//

If you have problems or comments...

PBIL Back to PBIL home page