(data stored in ACNUC7421 zone)

EMBL: CP001509.PRFH

CP001509.PRFH        Location/Qualifiers
FT   CDS             258196..258696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfH"
FT                   /locus_tag="ECD_00231"
FT                   /product="peptide chain release factor 2"
FT                   /note="similar to b0236"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00231"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42130"
FT                   /protein_id="ACT42130.1"
FT                   /translation="MLETETGRYSDTLRSALVSLDGDNAWALSESWCGTIQWICPSPYR
FT                   PHHGRKNWFLGIGRFTADEKEQSDAIRYETLRSSGPGGQHVNKTDSAVRATHLASGISV
FT                   KVQSERSQHANKRLARLLIAWKLEQQQQENSAALKSQRRMFHHQIERGNPRRTFTGMAF
FT                   IEG"
     MLETETGRYS DTLRSALVSL DGDNAWALSE SWCGTIQWIC PSPYRPHHGR KNWFLGIGRF        60
     TADEKEQSDA IRYETLRSSG PGGQHVNKTD SAVRATHLAS GISVKVQSER SQHANKRLAR       120
     LLIAWKLEQQ QQENSAALKS QRRMFHHQIE RGNPRRTFTG MAFIEG                      166
//

If you have problems or comments...

PBIL Back to PBIL home page