(data stored in ACNUC7421 zone)

EMBL: CP001509.PRIC

CP001509.PRIC        Location/Qualifiers
FT   CDS             complement(459331..459858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priC"
FT                   /locus_tag="ECD_00418"
FT                   /product="primosomal replication protein N''"
FT                   /note="similar to b0467"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00418"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42317"
FT                   /protein_id="ACT42317.1"
FT                   /translation="MKTALLLEKLEGQLATLRQRCAPVSQFATLSARFDRHLFQTRATT
FT                   LQACLDEAGDNLAALRHAVEQQQLPQVAWLAEHLAAQLEAIAREASAWSLREWDSAPPK
FT                   IARWQRKRIQHQDFERRLREMVAERRARLARVTDLVEQQTLHREVEAYEARLARCRHAL
FT                   EKIENRLARLTR"
     MKTALLLEKL EGQLATLRQR CAPVSQFATL SARFDRHLFQ TRATTLQACL DEAGDNLAAL        60
     RHAVEQQQLP QVAWLAEHLA AQLEAIAREA SAWSLREWDS APPKIARWQR KRIQHQDFER       120
     RLREMVAERR ARLARVTDLV EQQTLHREVE AYEARLARCR HALEKIENRL ARLTR            175
//

If you have problems or comments...

PBIL Back to PBIL home page