(data stored in ACNUC7421 zone)

EMBL: CP001509.PRPR

CP001509.PRPR        Location/Qualifiers
FT   CDS             complement(316486..318072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpR"
FT                   /locus_tag="ECD_00285"
FT                   /product="propionate catabolism operon regulatory protein"
FT                   /note="similar to b0330"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00285"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42184"
FT                   /protein_id="ACT42184.1"
FT                   /translation="MAHPPRLNDDKPVIWTVSVTRLFELFRDISLEFDHLANITPIQLG
FT                   FEKAVTYIHKKLANERCDAIIAAGSNGAYLKSRLSVPVILIKPSGYDVLQALAKAGKLT
FT                   SSIGVVTYQETIPALVAFQKTFNLRLDQRSYITEEDARGQINELKANGTEAVVGAGLIT
FT                   DLAEEAGMTGIFIYSAATVRQAFSDALDMTRMSLRHNTHDATRNALRTRYVLGDMLGQS
FT                   PQMEQVRQTILLYARSSAAVLIEGETGTGKELAAQAIHREYFARHDARQGKKSHPFVAV
FT                   NCGAIAESLLEAELFGYEEGAFTGSRRGGRAGLFEIAHGGTLFLDEIGEMPLPLQTRLL
FT                   RVLEEKEVTRVGGHQPVPVDVRVISATHCNLEEDMRQGQFRRDLFYRLSILRLQLPPLR
FT                   ERVADILPLAESFLKVSLAALSTPFSAALRQGLQASETVLVHYDWPGNIRELRNMMERL
FT                   ALFLSVEPTPDLTPQFLQLLLPELARESAKTPAPRLLTPQQALEKFNGDKTAAANYLGI
FT                   SRTTFWRRLKS"
     MAHPPRLNDD KPVIWTVSVT RLFELFRDIS LEFDHLANIT PIQLGFEKAV TYIHKKLANE        60
     RCDAIIAAGS NGAYLKSRLS VPVILIKPSG YDVLQALAKA GKLTSSIGVV TYQETIPALV       120
     AFQKTFNLRL DQRSYITEED ARGQINELKA NGTEAVVGAG LITDLAEEAG MTGIFIYSAA       180
     TVRQAFSDAL DMTRMSLRHN THDATRNALR TRYVLGDMLG QSPQMEQVRQ TILLYARSSA       240
     AVLIEGETGT GKELAAQAIH REYFARHDAR QGKKSHPFVA VNCGAIAESL LEAELFGYEE       300
     GAFTGSRRGG RAGLFEIAHG GTLFLDEIGE MPLPLQTRLL RVLEEKEVTR VGGHQPVPVD       360
     VRVISATHCN LEEDMRQGQF RRDLFYRLSI LRLQLPPLRE RVADILPLAE SFLKVSLAAL       420
     STPFSAALRQ GLQASETVLV HYDWPGNIRE LRNMMERLAL FLSVEPTPDL TPQFLQLLLP       480
     ELARESAKTP APRLLTPQQA LEKFNGDKTA AANYLGISRT TFWRRLKS                    528
//

If you have problems or comments...

PBIL Back to PBIL home page