(data stored in ACNUC7421 zone)

EMBL: CP001509.PSIF

CP001509.PSIF        Location/Qualifiers
FT   CDS             367906..368226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psiF"
FT                   /locus_tag="ECD_00331"
FT                   /product="PsiF family protein"
FT                   /note="similar to b0384"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00331"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42230"
FT                   /protein_id="ACT42230.1"
FT                   /translation="MKITLLVTLLFGLVFLTTVGAAERTLTPQQQHMTSCNQQATAQAL
FT                   KGDARKTYMSDCLKNSKSAPGEKSLTPQQQKMRECNNQATQQSLKGDDRNKFMSACLKK
FT                   AA"
     MKITLLVTLL FGLVFLTTVG AAERTLTPQQ QHMTSCNQQA TAQALKGDAR KTYMSDCLKN        60
     SKSAPGEKSL TPQQQKMREC NNQATQQSLK GDDRNKFMSA CLKKAA                      106
//

If you have problems or comments...

PBIL Back to PBIL home page