(data stored in ACNUC7421 zone)

EMBL: CP001509.QUUD

CP001509.QUUD        Location/Qualifiers
FT   CDS             542551..542934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="quuD"
FT                   /locus_tag="ECD_00502"
FT                   /product="DLP12 prophage; putative antitermination protein"
FT                   /note="similar to b0551"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00502"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42400"
FT                   /protein_id="ACT42400.1"
FT                   /translation="MRDIQMVLERWGAWAANNHEDVTWSSIAAGFKGLIPSKVKSRPQC
FT                   CDDDAMIICGCMARLKKNNSDLHDLLVDYYVVGMTFMSLAGKHCCSDGYIGKRLQKAEG
FT                   IIEGMLMALDIRLEMDIVVNNSN"
     MRDIQMVLER WGAWAANNHE DVTWSSIAAG FKGLIPSKVK SRPQCCDDDA MIICGCMARL        60
     KKNNSDLHDL LVDYYVVGMT FMSLAGKHCC SDGYIGKRLQ KAEGIIEGML MALDIRLEMD       120
     IVVNNSN                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page