(data stored in ACNUC7421 zone)

EMBL: CP001509.R

CP001509.R           Location/Qualifiers
FT   CDS             765466..765942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="R"
FT                   /locus_tag="ECD_10030"
FT                   /product="cell lysis protein"
FT                   /note="similar to lambdap75"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10030"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42612"
FT                   /protein_id="ACT42612.1"
FT                   /translation="MVEINNQRKAFLDMLAWSEGTDNGRQKTRNHGYDVIVGGELFTDY
FT                   SDHPRKLVTLNPKLKSTGAGRYQLLSRWWDAYRKQLGLKDFSPKSQDAVALQQIKERGA
FT                   LPMIDRGDIRQAIDRCSNIWASLPGAGYGQFEHKADSLIAKFKEAGGTVREIDV"
     MVEINNQRKA FLDMLAWSEG TDNGRQKTRN HGYDVIVGGE LFTDYSDHPR KLVTLNPKLK        60
     STGAGRYQLL SRWWDAYRKQ LGLKDFSPKS QDAVALQQIK ERGALPMIDR GDIRQAIDRC       120
     SNIWASLPGA GYGQFEHKAD SLIAKFKEAG GTVREIDV                               158
//

If you have problems or comments...

PBIL Back to PBIL home page