(data stored in ACNUC7421 zone)

EMBL: CP001509.RCLA

CP001509.RCLA        Location/Qualifiers
FT   CDS             complement(288304..289629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rclA"
FT                   /locus_tag="ECD_00260"
FT                   /product="reactive chlorine stress species (RCS) resistance
FT                   protein; pyridine nucleotide-dependent disulfide
FT                   oxidoreductase family"
FT                   /note="similar to b0304"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00260"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42159"
FT                   /protein_id="ACT42159.1"
FT                   /translation="MNKYQAVIIGFGKAGKTLAVTLAKAGWRVALIEQSNAMYGGTCIN
FT                   IGCIPTKTLVHDAQQHTDFVRAIQRKNEVVNFLRNKNFHNLADMPNIDVIDGQAEFINN
FT                   HSLRVHRPEGNLEIHGEKIFINTGAQTVVPPIPGITTTPGVYDSTGLLNLKELPGHLGI
FT                   LGGGYIGVEFASMFANFGSKVTILEAASLFLPREDRDIADNIATILRDQGVDIILNAHV
FT                   ERISHHENQVQVHSEHAQLAVDALLIASGRQPATASLHPENAGIAVNERGATVVDKRLH
FT                   TTADNIWAMGDVTGGLQFTYISLDDYRIVRDELLGEGKRSTDDRKNVPYSVFMTPPLSR
FT                   VGMTEEQARESGADIQVVTLPVAAIPRARVMNDTRGVLKAIVDNKTQRMLGASLLCVDS
FT                   HEMINIVKMVMDAGLPYSILRDQIFTHPSMSESLNDLFSLVK"
     MNKYQAVIIG FGKAGKTLAV TLAKAGWRVA LIEQSNAMYG GTCINIGCIP TKTLVHDAQQ        60
     HTDFVRAIQR KNEVVNFLRN KNFHNLADMP NIDVIDGQAE FINNHSLRVH RPEGNLEIHG       120
     EKIFINTGAQ TVVPPIPGIT TTPGVYDSTG LLNLKELPGH LGILGGGYIG VEFASMFANF       180
     GSKVTILEAA SLFLPREDRD IADNIATILR DQGVDIILNA HVERISHHEN QVQVHSEHAQ       240
     LAVDALLIAS GRQPATASLH PENAGIAVNE RGATVVDKRL HTTADNIWAM GDVTGGLQFT       300
     YISLDDYRIV RDELLGEGKR STDDRKNVPY SVFMTPPLSR VGMTEEQARE SGADIQVVTL       360
     PVAAIPRARV MNDTRGVLKA IVDNKTQRML GASLLCVDSH EMINIVKMVM DAGLPYSILR       420
     DQIFTHPSMS ESLNDLFSLV K                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page