(data stored in ACNUC7421 zone)

EMBL: CP001509.RCLC

CP001509.RCLC        Location/Qualifiers
FT   CDS             complement(287354..287947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rclC"
FT                   /locus_tag="ECD_00258"
FT                   /product="reactive chlorine species (RCS) stress resistance
FT                   inner membrane protein"
FT                   /note="similar to b0301"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00258"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42157"
FT                   /protein_id="ACT42157.1"
FT                   /translation="MEKYLHLLSRGDKIGLTLIRLSIAIVFMWIGLLKFVPYEADSITP
FT                   FVANSPLMSFFYEHPEDYKQYLTHEGEYKPEARAWQTANNTYGFSNGLGVVEVIIALLV
FT                   LANPVNRWLGLLGGLMAFTTPLVTLSFLITTPEAWVPALGDAHHGFPYLSGAGRLVLKD
FT                   TLMLAGAVMIMADSAREILKQRSNESSSTLKTEY"
     MEKYLHLLSR GDKIGLTLIR LSIAIVFMWI GLLKFVPYEA DSITPFVANS PLMSFFYEHP        60
     EDYKQYLTHE GEYKPEARAW QTANNTYGFS NGLGVVEVII ALLVLANPVN RWLGLLGGLM       120
     AFTTPLVTLS FLITTPEAWV PALGDAHHGF PYLSGAGRLV LKDTLMLAGA VMIMADSARE       180
     ILKQRSNESS STLKTEY                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page