(data stored in ACNUC7421 zone)

EMBL: CP001509.RDGC

CP001509.RDGC        Location/Qualifiers
FT   CDS             complement(374510..375421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgC"
FT                   /locus_tag="ECD_00342"
FT                   /product="nucleoid-associated ssDNA and dsDNA binding
FT                   protein; competitive inhibitor of RecA function"
FT                   /note="similar to b0393"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00342"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42241"
FT                   /protein_id="ACT42241.1"
FT                   /translation="MLWFKNLMVYRLSREISLRAEEMEKQLASMAFTPCGSQDMAKMGW
FT                   VPPMGSHSDALTHVANGQIVICARKEEKILPSPVIKQALEAKIAKLEAEQARKLKKTEK
FT                   DSLKDEVLHSLLPRAFSRFSQTMMWIDTVNGLIMVDCASAKKAEDTLALLRKSLGSLPV
FT                   VPLSMENPIELTLTEWVRSGSAAQGFQLLDEAELKSLLEDGGVIRAKKQDLTSEEITNH
FT                   IEAGKVVTKLALDWQQRIQFVMCDDGSLKRLKFCDELRDQNEDIDREDFAQRFDADFIL
FT                   MTGELAALIQNLIEGLGGEAQR"
     MLWFKNLMVY RLSREISLRA EEMEKQLASM AFTPCGSQDM AKMGWVPPMG SHSDALTHVA        60
     NGQIVICARK EEKILPSPVI KQALEAKIAK LEAEQARKLK KTEKDSLKDE VLHSLLPRAF       120
     SRFSQTMMWI DTVNGLIMVD CASAKKAEDT LALLRKSLGS LPVVPLSMEN PIELTLTEWV       180
     RSGSAAQGFQ LLDEAELKSL LEDGGVIRAK KQDLTSEEIT NHIEAGKVVT KLALDWQQRI       240
     QFVMCDDGSL KRLKFCDELR DQNEDIDRED FAQRFDADFI LMTGELAALI QNLIEGLGGE       300
     AQR                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page