(data stored in ACNUC7421 zone)

EMBL: CP001509.RECR

CP001509.RECR        Location/Qualifiers
FT   CDS             463451..464056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="ECD_00423"
FT                   /product="gap repair protein"
FT                   /note="similar to b0472"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00423"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42322"
FT                   /protein_id="ACT42322.1"
FT                   /translation="MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQ
FT                   ALTRAMSEIGHCADCRTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGR
FT                   YFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQ
FT                   YDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIRF"
     MQTSPLLTQL MEALRCLPGV GPKSAQRMAF TLLQRDRSGG MRLAQALTRA MSEIGHCADC        60
     RTFTEQEVCN ICSNPRRQEN GQICVVESPA DIYAIEQTGQ FSGRYFVLMG HLSPLDGIGP       120
     DDIGLDRLEQ RLAEEKITEV ILATNPTVEG EATANYIAEL CAQYDVEASR IAHGVPVGGE       180
     LEMVDGTTLS HSLAGRHKIR F                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page