(data stored in ACNUC7421 zone)

EMBL: CP001509.REN

CP001509.REN         Location/Qualifiers
FT   CDS             763059..763862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ren"
FT                   /locus_tag="ECD_10026"
FT                   /product="ren exclusion protein"
FT                   /note="similar to lambdap62"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10026"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42608"
FT                   /protein_id="ACT42608.1"
FT                   /translation="MTGKEAIIHYLGTHNSFCAPDVAALTGATVTSINQAAAKMARAGL
FT                   LVIEGKVWRTVYYRFATREEREGKMSTNLMNKLDTIGFDNKKDLLISVGDLVDRGAENV
FT                   ECLELITFPWFRAVRGNHEQMMIDGLSERGNVNHWLLNGGGWFFNLDYDKEILAKALAH
FT                   KADELPLIIELVSKDKKYVICHADYPFDEYEFGKPVDHQQVIWNRERISNSQNGIVKEI
FT                   KGADTFIFGHTPAVKPLKFANQMYIDTGAVFCGNLTLIQVQGEGA"
     MTGKEAIIHY LGTHNSFCAP DVAALTGATV TSINQAAAKM ARAGLLVIEG KVWRTVYYRF        60
     ATREEREGKM STNLMNKLDT IGFDNKKDLL ISVGDLVDRG AENVECLELI TFPWFRAVRG       120
     NHEQMMIDGL SERGNVNHWL LNGGGWFFNL DYDKEILAKA LAHKADELPL IIELVSKDKK       180
     YVICHADYPF DEYEFGKPVD HQQVIWNRER ISNSQNGIVK EIKGADTFIF GHTPAVKPLK       240
     FANQMYIDTG AVFCGNLTLI QVQGEGA                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page