(data stored in ACNUC7421 zone)

EMBL: CP001509.REND

CP001509.REND        Location/Qualifiers
FT   CDS             536657..536842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="renD"
FT                   /locus_tag="ECD_00492"
FT                   /product="hypothetical protein"
FT                   /note="similar to b0542"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00492"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42390"
FT                   /protein_id="ACT42390.1"
FT                   /translation="MARAGILVVDGKVWRTVYYRFATREEREGKVSTNLIFKECRQSAA
FT                   MKRVLRVYKRTSMGTQ"
     MARAGILVVD GKVWRTVYYR FATREEREGK VSTNLIFKEC RQSAAMKRVL RVYKRTSMGT        60
     Q                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page