(data stored in ACNUC7421 zone)

EMBL: CP001509.RHSC

CP001509.RHSC        Location/Qualifiers
FT   CDS             689635..691299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhsC"
FT                   /locus_tag="ECD_00658"
FT                   /product="Rhs protein with putative toxin domain; putative
FT                   neighboring cell growth inhibitor"
FT                   /note="similar to b0700"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00658"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42534"
FT                   /protein_id="ACT42534.1"
FT                   /translation="MKPTSPCPPRCRSSSPAPTAVTGQKRPRRWGASAPAGKCLRITGV
FT                   HTTAANLDIRIPYATDPAGNRLPDPELHPDSTLSMWPDNRIARDAHYLYRYDRHGRLTE
FT                   KTDLIPEGVIRTDDERTHQYHYDSQHRLVHYTRTQYAEPLVESRYLYDPLGRRVAKRVW
FT                   RRERDLTGWMSLSRKPEVTWYGWDGDRLTTIQNDRTRIQTIYQPGSFTPLIRVETATGE
FT                   LAKTQRRSLADTLQQSGGEDGGSVVFPPVLVQMLDRLESEILADRVSEESRRWLASCGL
FT                   TVAQMQNQMDPVYTPARKIHLYHCDHRGLPLALISKEGATEWCAEYDEWGNLLNEENPH
FT                   QLQQLIRLPGQQYDEESGLYYNRHRYYDPLQGRYITQDPIGLKGGWNFYQYPLNPISNI
FT                   DPLGLETLKCIKPLHSMGGTGERSGPDIWGNPFYHQYLCVPDGKGDYTCGGQDQRGESK
FT                   GDGLWGPGKASNDTKEAAGRCDLVETDNSCVENCLKGKFKEVRPRYSVLPDIFTPINLG
FT                   LFKNCQDWSNDSLETCKMKCSGNNIGRFIRFVFTGVM"
     MKPTSPCPPR CRSSSPAPTA VTGQKRPRRW GASAPAGKCL RITGVHTTAA NLDIRIPYAT        60
     DPAGNRLPDP ELHPDSTLSM WPDNRIARDA HYLYRYDRHG RLTEKTDLIP EGVIRTDDER       120
     THQYHYDSQH RLVHYTRTQY AEPLVESRYL YDPLGRRVAK RVWRRERDLT GWMSLSRKPE       180
     VTWYGWDGDR LTTIQNDRTR IQTIYQPGSF TPLIRVETAT GELAKTQRRS LADTLQQSGG       240
     EDGGSVVFPP VLVQMLDRLE SEILADRVSE ESRRWLASCG LTVAQMQNQM DPVYTPARKI       300
     HLYHCDHRGL PLALISKEGA TEWCAEYDEW GNLLNEENPH QLQQLIRLPG QQYDEESGLY       360
     YNRHRYYDPL QGRYITQDPI GLKGGWNFYQ YPLNPISNID PLGLETLKCI KPLHSMGGTG       420
     ERSGPDIWGN PFYHQYLCVP DGKGDYTCGG QDQRGESKGD GLWGPGKASN DTKEAAGRCD       480
     LVETDNSCVE NCLKGKFKEV RPRYSVLPDI FTPINLGLFK NCQDWSNDSL ETCKMKCSGN       540
     NIGRFIRFVF TGVM                                                         554
//

If you have problems or comments...

PBIL Back to PBIL home page