(data stored in ACNUC7421 zone)

EMBL: CP001509.RHSD

CP001509.RHSD        Location/Qualifiers
FT   CDS             492407..496687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhsD"
FT                   /locus_tag="ECD_00448"
FT                   /product="Rhs protein with DUF4329 family putative toxin
FT                   domain; putative neighboring cell growth inhibitor"
FT                   /note="similar to b0497"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00448"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42347"
FT                   /protein_id="ACT42347.1"
FT                   /translation="MSGKPAARQGDMTQYGGPIVQGSAGVRIGAPTGVACSVCPGGMTS
FT                   GNPVNPLLGAKVLPGETDLALPGPLPFILSRTYSSYRTRTPAPVGVFGPGWKAPSDIRL
FT                   QLRDDALVLNDNGGRSIHFEPLLPGEAVYSRSESMWLVRGGKAAQPDGHTLARLWGALP
FT                   PDIRLSPHLYLATNSAQGPWWILGWSERVPGAEDVLPAPLPPYRVLTGLADRFGRTLTY
FT                   RREAAGDLAGEITGVTDGAGREFRLVLTTQAQRAEEARTSSLSSSDSSRPLSASAFPDT
FT                   LPGTEYGPDRGIRLSAVWLMHDPAYPESLPAAPLVRYTYTEAGELLAVYDRSNTQVRAF
FT                   TYDAQHPGRMVAHRYAGRPEMRYRYDDTGRVVEQLNPAGLSYRYLYEQDRITVTDSLNR
FT                   REVLHTEGGAGLKRVVKKELADGSVTRSGYDAAGRLTAQTDAAGRRTEYGLNVVSGDIT
FT                   DITTPDGRETKFYYNDGNQLTAVVYPDGLESRREYDEPGRLVSETSRSGETVRYRYDDA
FT                   HSELPATTTDATGSTRQMTWSRYGQLLAFTDCSGYQTRYEYDRFGQMTAVHREEGISLY
FT                   RHYDNRGRLTSVKDAQGRETRYEYNAAGDLTAVITPDGNRSETQYDAWGKAVSTTQGGL
FT                   TRSMEYDAAGRVISLTNENGSHSVFSYDALDRLVQQGGFDGRTQRYHYDLTGKLTQSED
FT                   EGLVILWYYDASDRITHRTVNGEPAEQWQYDGHGWLTDISHLSEGHRVAVHYGYDDKGR
FT                   LTGECQTVENPETGELLWQHETKHAYNEQGLANRVTPDSLPPVEWLTYGSGYLAGMKLG
FT                   GTPLVEYTRDRLHRETVRSFGSMAGSNAAYELTSTYTPAGQLQSQHLNSLVYDRDYGWS
FT                   DNGDLVRISGPRQTREYGYSATGRLESVRTLAPDLDIRIPYATDPAGNRLPDPELHPDS
FT                   TLTVWPDNRIAEDAHYVYRHDEYGRLTEKTDRIPAGVIRTDDERTHHYHYDSQHRLVFY
FT                   TRIQHGEPLVESRYLYDPLGRRMAKRVWRRERDLTGWMSLSRKPEVTWYGWDGDRLTTV
FT                   QTDTTRIQTVYEPGSFTPLIRVETENGEREKAQRRSLAETLQQEGSENGHGVVFPAELV
FT                   RLLDRLEEEIRADRVSSESRAWLAQCGLTVEQLARQVEPEYTPARKAHLYHCDHRGLPL
FT                   ALISEDGNTAWSAEYDEWGNQLNEENPHHVYQPYRLPGQQHDEESGLYYNRHRYYDPLQ
FT                   GRYITQDPMGLKGGWNLYQYPLNPLQQIDPMGLLQTWDDARSGACTGGVCGVLSRIIGP
FT                   SKFDSTADAALDALKETQNRSLCNDMEYSGIVCKDTNGKYFASKAETDNLRKESYPLKR
FT                   KCPTGTDRVAAYHTHGADSHGDYVDEFFSSSDKNLVRSKDNNLEAFYLATPDGRFEALN
FT                   NKGEYIFIRNSVPGLSSVCIPYHD"
     MSGKPAARQG DMTQYGGPIV QGSAGVRIGA PTGVACSVCP GGMTSGNPVN PLLGAKVLPG        60
     ETDLALPGPL PFILSRTYSS YRTRTPAPVG VFGPGWKAPS DIRLQLRDDA LVLNDNGGRS       120
     IHFEPLLPGE AVYSRSESMW LVRGGKAAQP DGHTLARLWG ALPPDIRLSP HLYLATNSAQ       180
     GPWWILGWSE RVPGAEDVLP APLPPYRVLT GLADRFGRTL TYRREAAGDL AGEITGVTDG       240
     AGREFRLVLT TQAQRAEEAR TSSLSSSDSS RPLSASAFPD TLPGTEYGPD RGIRLSAVWL       300
     MHDPAYPESL PAAPLVRYTY TEAGELLAVY DRSNTQVRAF TYDAQHPGRM VAHRYAGRPE       360
     MRYRYDDTGR VVEQLNPAGL SYRYLYEQDR ITVTDSLNRR EVLHTEGGAG LKRVVKKELA       420
     DGSVTRSGYD AAGRLTAQTD AAGRRTEYGL NVVSGDITDI TTPDGRETKF YYNDGNQLTA       480
     VVYPDGLESR REYDEPGRLV SETSRSGETV RYRYDDAHSE LPATTTDATG STRQMTWSRY       540
     GQLLAFTDCS GYQTRYEYDR FGQMTAVHRE EGISLYRHYD NRGRLTSVKD AQGRETRYEY       600
     NAAGDLTAVI TPDGNRSETQ YDAWGKAVST TQGGLTRSME YDAAGRVISL TNENGSHSVF       660
     SYDALDRLVQ QGGFDGRTQR YHYDLTGKLT QSEDEGLVIL WYYDASDRIT HRTVNGEPAE       720
     QWQYDGHGWL TDISHLSEGH RVAVHYGYDD KGRLTGECQT VENPETGELL WQHETKHAYN       780
     EQGLANRVTP DSLPPVEWLT YGSGYLAGMK LGGTPLVEYT RDRLHRETVR SFGSMAGSNA       840
     AYELTSTYTP AGQLQSQHLN SLVYDRDYGW SDNGDLVRIS GPRQTREYGY SATGRLESVR       900
     TLAPDLDIRI PYATDPAGNR LPDPELHPDS TLTVWPDNRI AEDAHYVYRH DEYGRLTEKT       960
     DRIPAGVIRT DDERTHHYHY DSQHRLVFYT RIQHGEPLVE SRYLYDPLGR RMAKRVWRRE      1020
     RDLTGWMSLS RKPEVTWYGW DGDRLTTVQT DTTRIQTVYE PGSFTPLIRV ETENGEREKA      1080
     QRRSLAETLQ QEGSENGHGV VFPAELVRLL DRLEEEIRAD RVSSESRAWL AQCGLTVEQL      1140
     ARQVEPEYTP ARKAHLYHCD HRGLPLALIS EDGNTAWSAE YDEWGNQLNE ENPHHVYQPY      1200
     RLPGQQHDEE SGLYYNRHRY YDPLQGRYIT QDPMGLKGGW NLYQYPLNPL QQIDPMGLLQ      1260
     TWDDARSGAC TGGVCGVLSR IIGPSKFDST ADAALDALKE TQNRSLCNDM EYSGIVCKDT      1320
     NGKYFASKAE TDNLRKESYP LKRKCPTGTD RVAAYHTHGA DSHGDYVDEF FSSSDKNLVR      1380
     SKDNNLEAFY LATPDGRFEA LNNKGEYIFI RNSVPGLSSV CIPYHD                     1426
//

If you have problems or comments...

PBIL Back to PBIL home page