(data stored in ACNUC7421 zone)

EMBL: CP001509.RHSH

CP001509.RHSH        Location/Qualifiers
FT   CDS             497095..497805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhsH"
FT                   /locus_tag="ECD_00450"
FT                   /product="conserved protein, rhs-like protein"
FT                   /note="similar to b0499"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00450"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42349"
FT                   /protein_id="ACT42349.1"
FT                   /translation="MLALMDADGNIAWSGEYDEWGNQLNEENPHHLHQPYRLPGQQYDK
FT                   ESGLYYNRNRYYDPLQGRYITQDPIGLEGGWSLYAYPLNPVNGIDPLGLSPADVALIRR
FT                   KDQLNHQRAWDILSDTYEDMKRLNLGGTDQFFHCMAFCRVSKLNDAGVSRSAKGLGYEK
FT                   EIRDYGLNLFGMYGRKVKLSHSEMIEDNKKDLAVNDHGLTCPSTTDCSDRCSDYINPEH
FT                   KKTIKALQDAGYLK"
     MLALMDADGN IAWSGEYDEW GNQLNEENPH HLHQPYRLPG QQYDKESGLY YNRNRYYDPL        60
     QGRYITQDPI GLEGGWSLYA YPLNPVNGID PLGLSPADVA LIRRKDQLNH QRAWDILSDT       120
     YEDMKRLNLG GTDQFFHCMA FCRVSKLNDA GVSRSAKGLG YEKEIRDYGL NLFGMYGRKV       180
     KLSHSEMIED NKKDLAVNDH GLTCPSTTDC SDRCSDYINP EHKKTIKALQ DAGYLK           236
//

If you have problems or comments...

PBIL Back to PBIL home page