(data stored in ACNUC7421 zone)

EMBL: CP001509.RHSO

CP001509.RHSO        Location/Qualifiers
FT   CDS             691743..693176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhsO"
FT                   /locus_tag="ECD_00660"
FT                   /product="conserved protein, rhs-like protein"
FT                   /note="similar to b0703"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00660"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42536"
FT                   /protein_id="ACT42536.1"
FT                   /translation="MWPDNRIARDAHYLYRYDRHGRLTEKTDLIPEGVIRTDDERTHRY
FT                   HYDSQHRLVHYTRTQYAEPLVESRYLYDPLGRRVAKRVWRRERDLTGWMSLSRKPQVTW
FT                   YGWDGDRLTTIQNDRSRIQTIYQPGSFTPLIRVETATGELARTQRRSLADALQQSGGED
FT                   GGSVVFPPVLVQMLDRLESEILADRVSEESRRWLASCGLTVEQMQNQMDPVYTPARKIH
FT                   LYHCDHRGLPLALVSTEGATEWCAEYDEWGNLLNEENPHQLQQLIRLPGQQYDEESGLY
FT                   YNRHRYYDPLQGRYITQDPIGLKGGWNFYQYPLNPVQYIDSMGLASKYGHLNNGGYGAR
FT                   PNKPPTPDPSKLPDIAKQLRLPYPIDQASSAPNVFKTFFRALSPYDYTLYCRKWVKPNL
FT                   TCTPQDDSQYPGMDTKTASDYLPQTNWPTTQLPPGYTCAEPYLFPDINKPDGPATAGID
FT                   DLGEILAKMKQRTSRGIRK"
     MWPDNRIARD AHYLYRYDRH GRLTEKTDLI PEGVIRTDDE RTHRYHYDSQ HRLVHYTRTQ        60
     YAEPLVESRY LYDPLGRRVA KRVWRRERDL TGWMSLSRKP QVTWYGWDGD RLTTIQNDRS       120
     RIQTIYQPGS FTPLIRVETA TGELARTQRR SLADALQQSG GEDGGSVVFP PVLVQMLDRL       180
     ESEILADRVS EESRRWLASC GLTVEQMQNQ MDPVYTPARK IHLYHCDHRG LPLALVSTEG       240
     ATEWCAEYDE WGNLLNEENP HQLQQLIRLP GQQYDEESGL YYNRHRYYDP LQGRYITQDP       300
     IGLKGGWNFY QYPLNPVQYI DSMGLASKYG HLNNGGYGAR PNKPPTPDPS KLPDIAKQLR       360
     LPYPIDQASS APNVFKTFFR ALSPYDYTLY CRKWVKPNLT CTPQDDSQYP GMDTKTASDY       420
     LPQTNWPTTQ LPPGYTCAEP YLFPDINKPD GPATAGIDDL GEILAKMKQR TSRGIRK          477
//

If you have problems or comments...

PBIL Back to PBIL home page