(data stored in ACNUC7421 zone)

EMBL: CP001509.RZ

CP001509.RZ          Location/Qualifiers
FT   CDS             765939..766400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Rz"
FT                   /locus_tag="ECD_10031"
FT                   /product="cell lysis protein"
FT                   /note="similar to lambdap76"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10031"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42613"
FT                   /protein_id="ACT42613.1"
FT                   /translation="MSRVTAIISALVICIIVCLSWAVNHYRDNAITYKAQRDKNARELK
FT                   LANAAITDMQMRQRDVAALDAKYTKELADAKAENDALRDDVAAGRRRLHIKAVCQSVRE
FT                   ATTASGVDNAASPRLADTAERDYFTLRERLITMQKQLEGTQKYINEQCR"
     MSRVTAIISA LVICIIVCLS WAVNHYRDNA ITYKAQRDKN ARELKLANAA ITDMQMRQRD        60
     VAALDAKYTK ELADAKAEND ALRDDVAAGR RRLHIKAVCQ SVREATTASG VDNAASPRLA       120
     DTAERDYFTL RERLITMQKQ LEGTQKYINE QCR                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page