(data stored in ACNUC7421 zone)

EMBL: CP001509.S

CP001509.S           Location/Qualifiers
FT   CDS             765159..765482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="S"
FT                   /locus_tag="ECD_10029"
FT                   /product="cell lysis protein"
FT                   /note="similar to lambdap74"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10029"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42611"
FT                   /protein_id="ACT42611.1"
FT                   /translation="MKMPEKHDLLAAILAAKEQGIGAILAFAMAYLRGRYNGGAFTKTV
FT                   IDATMCAIIAWFIRDLLDFAGLSSNLAYITSVFIGYIGTDSIGSLIKRFAAKKAGVEDG
FT                   RNQ"
     MKMPEKHDLL AAILAAKEQG IGAILAFAMA YLRGRYNGGA FTKTVIDATM CAIIAWFIRD        60
     LLDFAGLSSN LAYITSVFIG YIGTDSIGSL IKRFAAKKAG VEDGRNQ                     107
//

If you have problems or comments...

PBIL Back to PBIL home page