(data stored in ACNUC7421 zone)

EMBL: CP001509.SBMA

CP001509.SBMA        Location/Qualifiers
FT   CDS             361264..362484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbmA"
FT                   /locus_tag="ECD_00324"
FT                   /product="peptide antibiotic transporter"
FT                   /note="similar to b0377"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00324"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42223"
FT                   /protein_id="ACT42223.1"
FT                   /translation="MFKSFFPKPGAFFLSAFVWALIAVIFWQAGGGDWVARITGASGQI
FT                   PISAARFWSLDFLIFYAYYIVCVGLFAFFWFIYSPHRWQYWSILGTALIIFVTWFLVEV
FT                   GVAVNAWYAPFYDLIQTALSSPHKVTIEQFYREVGVFLGIALIAVVISVLNNFFVSHYV
FT                   FRWRTAMNEYYMANWQQLRHIEGAAQRVQEDTMRFASTLENMGVSFINAIMTLIAFLPV
FT                   LVTLSAHVPELPIIGHIPYGLVIAAIVWSLMGTGLLAVVGIKLPGLEFKNQRVEAAYRK
FT                   ELVYGEDDATRATPPTVRELFSAVRKNYFRLYFHYMYFNIARILYLQVDNVFGLFLLFP
FT                   SIVAGTITLGLMTQITNVFGQVRGAFQYLINSWTTLVELMSIYKRLRSFEHELDGDKIQ
FT                   EVTHTLS"
     MFKSFFPKPG AFFLSAFVWA LIAVIFWQAG GGDWVARITG ASGQIPISAA RFWSLDFLIF        60
     YAYYIVCVGL FAFFWFIYSP HRWQYWSILG TALIIFVTWF LVEVGVAVNA WYAPFYDLIQ       120
     TALSSPHKVT IEQFYREVGV FLGIALIAVV ISVLNNFFVS HYVFRWRTAM NEYYMANWQQ       180
     LRHIEGAAQR VQEDTMRFAS TLENMGVSFI NAIMTLIAFL PVLVTLSAHV PELPIIGHIP       240
     YGLVIAAIVW SLMGTGLLAV VGIKLPGLEF KNQRVEAAYR KELVYGEDDA TRATPPTVRE       300
     LFSAVRKNYF RLYFHYMYFN IARILYLQVD NVFGLFLLFP SIVAGTITLG LMTQITNVFG       360
     QVRGAFQYLI NSWTTLVELM SIYKRLRSFE HELDGDKIQE VTHTLS                      406
//

If you have problems or comments...

PBIL Back to PBIL home page