(data stored in ACNUC7421 zone)

EMBL: CP001509.SDHB

CP001509.SDHB        Location/Qualifiers
FT   CDS             716259..716975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="ECD_00684"
FT                   /product="succinate dehydrogenase, FeS subunit"
FT                   /note="similar to b0724"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00684"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42559"
FT                   /protein_id="ACT42559.1"
FT                   /translation="MRLEFSIYRYNPDVDDAPRMQDYTLEAEEGRDMMLLDALIQLKEK
FT                   DPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLV
FT                   VDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFW
FT                   WNPDKFIGPAGLLAAYRFLIDSRDTETGSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNP
FT                   TRAIGHIKSMLLQRNA"
     MRLEFSIYRY NPDVDDAPRM QDYTLEAEEG RDMMLLDALI QLKEKDPSLS FRRSCREGVC        60
     GSDGLNMNGK NGLACITPIS ALNQPGKKIV IRPLPGLPVI RDLVVDMGQF YAQYEKIKPY       120
     LLNNGQNPPA REHLQMPEQR EKLDGLYECI LCACCSTSCP SFWWNPDKFI GPAGLLAAYR       180
     FLIDSRDTET GSRLDGLSDA FSVFRCHSIM NCVSVCPKGL NPTRAIGHIK SMLLQRNA         238
//

If you have problems or comments...

PBIL Back to PBIL home page