(data stored in ACNUC7421 zone)

EMBL: CP001509.SDHD

CP001509.SDHD        Location/Qualifiers
FT   CDS             714130..714477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="ECD_00682"
FT                   /product="succinate dehydrogenase, membrane subunit, binds
FT                   cytochrome b556"
FT                   /note="similar to b0722"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00682"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42557"
FT                   /protein_id="ACT42557.1"
FT                   /translation="MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTY
FT                   EVWIGFFASAFTKVFTLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVY
FT                   VIYGFVVVWGV"
     MVSNASALGR NGVHDFILVR ATAIVLTLYI IYMVGFFATS GELTYEVWIG FFASAFTKVF        60
     TLLALFSILI HAWIGMWQVL TDYVKPLALR LMLQLVIVVA LVVYVIYGFV VVWGV            115
//

If you have problems or comments...

PBIL Back to PBIL home page