(data stored in ACNUC7421 zone)

EMBL: CP001509.SFMA

CP001509.SFMA        Location/Qualifiers
FT   CDS             527299..527841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmA"
FT                   /locus_tag="ECD_00480"
FT                   /product="FimA-like protein"
FT                   /note="similar to b0530"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42379"
FT                   /protein_id="ACT42379.1"
FT                   /translation="MKLRFISSALAAALFAATGSYAAVVDGGTIHFEGELVNAACSVNT
FT                   DSADQVVTLGQYRTDIFNAVGNTSALIPFTIQLNDCDPVVAANAAVAFSGQADAINDNL
FT                   LAIASSTNTTTATGVGIEILDNTSAILKPDGNSFSTNQNLIPGTNVLHFSARYKGTGTS
FT                   ASAGQANADATFIMRYE"
     MKLRFISSAL AAALFAATGS YAAVVDGGTI HFEGELVNAA CSVNTDSADQ VVTLGQYRTD        60
     IFNAVGNTSA LIPFTIQLND CDPVVAANAA VAFSGQADAI NDNLLAIASS TNTTTATGVG       120
     IEILDNTSAI LKPDGNSFST NQNLIPGTNV LHFSARYKGT GTSASAGQAN ADATFIMRYE       180
//

If you have problems or comments...

PBIL Back to PBIL home page