(data stored in ACNUC7421 zone)

EMBL: CP001509.SFMF

CP001509.SFMF        Location/Qualifiers
FT   CDS             532423..532938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmF"
FT                   /locus_tag="ECD_00484"
FT                   /product="FimA-like protein"
FT                   /note="similar to b0534"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00484"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42383"
FT                   /protein_id="ACT42383.1"
FT                   /translation="MRRVLFSCFCGLLWSSSGWAADPLGTININLHGNVVDFSCTVNTA
FT                   DIDKTVDLGRWPTTQLLNAGDTTALVPFSLRLEGCPPGSVAILFTGTPASDTNLLALDD
FT                   PAMAQTVAIELRNSDRSRLALGEASPTEEVDANGNVTLNFFANYRALASGVRPGVAKAD
FT                   AIFMINYN"
     MRRVLFSCFC GLLWSSSGWA ADPLGTININ LHGNVVDFSC TVNTADIDKT VDLGRWPTTQ        60
     LLNAGDTTAL VPFSLRLEGC PPGSVAILFT GTPASDTNLL ALDDPAMAQT VAIELRNSDR       120
     SRLALGEASP TEEVDANGNV TLNFFANYRA LASGVRPGVA KADAIFMINY N                171
//

If you have problems or comments...

PBIL Back to PBIL home page