(data stored in ACNUC7421 zone)

EMBL: CP001509.SFMH

CP001509.SFMH        Location/Qualifiers
FT   CDS             531435..532412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmH"
FT                   /locus_tag="ECD_00483"
FT                   /product="FimA-like protein"
FT                   /note="similar to b0533"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00483"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42382"
FT                   /protein_id="ACT42382.1"
FT                   /translation="MACLCLANISWATVCANSTGVAEDEHYDLSNIFNSTNNQPGQIVV
FT                   LPEKSGWVGVSAICPPGTLVNYTYRSYVTNFIVQETIDNYKYMQLHDYLLGAMSLVDSV
FT                   MDIQFPPQNYIRMGTDPNVSQNLPFGVMDSRLIFRLKVIRPFINMVEIPRQVMFTVYVT
FT                   STPYDPLVTPVYTISFGGRVEVPQNCELNAGQIVEFDFGDIGASLFSAAGPGNRPAGVM
FT                   PQTKSIAVKCTNVAAQAYLTMRLEASAVSGQAMVSDNQDLGFIVADQNDTPITPNDLNS
FT                   VIPFRLDAAAAANVTLRAWPISITGQKPTEGPFSALGYLRVDYQ"
     MACLCLANIS WATVCANSTG VAEDEHYDLS NIFNSTNNQP GQIVVLPEKS GWVGVSAICP        60
     PGTLVNYTYR SYVTNFIVQE TIDNYKYMQL HDYLLGAMSL VDSVMDIQFP PQNYIRMGTD       120
     PNVSQNLPFG VMDSRLIFRL KVIRPFINMV EIPRQVMFTV YVTSTPYDPL VTPVYTISFG       180
     GRVEVPQNCE LNAGQIVEFD FGDIGASLFS AAGPGNRPAG VMPQTKSIAV KCTNVAAQAY       240
     LTMRLEASAV SGQAMVSDNQ DLGFIVADQN DTPITPNDLN SVIPFRLDAA AAANVTLRAW       300
     PISITGQKPT EGPFSALGYL RVDYQ                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page