(data stored in ACNUC7421 zone)

EMBL: CP001509.SFMZ

CP001509.SFMZ        Location/Qualifiers
FT   CDS             complement(532941..533573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmZ"
FT                   /locus_tag="ECD_00485"
FT                   /product="response regulator family protein"
FT                   /note="similar to b0535"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00485"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42384"
FT                   /protein_id="ACT42384.1"
FT                   /translation="MKPTSVIIMDTHPIIRMSIEVLLQKNSELQIVLKTDDYRITIDYL
FT                   RTRPVDLIIMDIDLPGTDGFTFLKRIKQIQSTVKVLFLSSKSECFYAGRAIQAGANGFV
FT                   SKCNDQNDIFHAVQMILSGYTFFPSETLNYIKSNKCSTNSSTITVLSNREVTILRYLVS
FT                   GLSNKEIADKLLLSNKTVSAHKSNIYGKLGLHSIVELIDYAKLYELI"
     MKPTSVIIMD THPIIRMSIE VLLQKNSELQ IVLKTDDYRI TIDYLRTRPV DLIIMDIDLP        60
     GTDGFTFLKR IKQIQSTVKV LFLSSKSECF YAGRAIQAGA NGFVSKCNDQ NDIFHAVQMI       120
     LSGYTFFPSE TLNYIKSNKC STNSSTITVL SNREVTILRY LVSGLSNKEI ADKLLLSNKT       180
     VSAHKSNIYG KLGLHSIVEL IDYAKLYELI                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page