(data stored in ACNUC7421 zone)

EMBL: CP001509.THIB

CP001509.THIB        Location/Qualifiers
FT   CDS             complement(77302..78285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiB"
FT                   /locus_tag="ECD_00070"
FT                   /product="thiamine/thiamine pyrophosphate/thiamine
FT                   monophosphate ABC transporter periplasmic binding protein"
FT                   /note="similar to b0068"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00070"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41971"
FT                   /protein_id="ACT41971.1"
FT                   /translation="MLKKCLPLLLLCTAPVFAKPVLTVYTYDSFAADWGPGPVVKKAFE
FT                   ADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNNLLDAASKTGLFAKSGVAAD
FT                   AVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNPPQSLKELVESDQNWRVIYQDPRTSTP
FT                   GLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYH
FT                   ILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPELAQKFLQFMVSPAFQNAIPTGNWM
FT                   YPVANVTLPAGFEKLTKPATTLEFTPAEVAAQRQAWISEWQRAVSR"
     MLKKCLPLLL LCTAPVFAKP VLTVYTYDSF AADWGPGPVV KKAFEADCNC ELKLVALEDG        60
     VSLLNRLRME GKNSKADVVL GLDNNLLDAA SKTGLFAKSG VAADAVNVPG GWNNDTFVPF       120
     DYGYFAFVYD KNKLKNPPQS LKELVESDQN WRVIYQDPRT STPGLGLLLW MQKVYGDDAP       180
     QAWQKLAKKT VTVTKGWSEA YGLFLKGESD LVLSYTTSPA YHILEEKKDN YAAANFSEGH       240
     YLQVEVAART AASKQPELAQ KFLQFMVSPA FQNAIPTGNW MYPVANVTLP AGFEKLTKPA       300
     TTLEFTPAEV AAQRQAWISE WQRAVSR                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page