(data stored in ACNUC7421 zone)

EMBL: CP001509.THIL

CP001509.THIL        Location/Qualifiers
FT   CDS             401035..402012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="ECD_00365"
FT                   /product="thiamine monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="similar to b0417"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00365"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42264"
FT                   /protein_id="ACT42264.1"
FT                   /translation="MACGEFSLIARYFDRVRSSRLDVELGIGDDCALLNIPEKQTLAIS
FT                   TDTLVAGNHFLPDIDPADLAYKALAVNLSDLAAMGADPAWLTLALTLPDVDEAWLESFS
FT                   DSLFDLLNYYDMQLIGGDTTRGPLSMTLGIHGFVPMGRALTRSGAKPGDWIYVTGTPGD
FT                   SAAGLAILQNRLQVADAKDADYLIKRHLRPSPRILQGQALRDLANSAIDLSDGLISDLG
FT                   HIVKASDCGARIDLALLPFSDALSRHVEPEQALRWALSGGEDYELCFTVPELNRGALDV
FT                   ALGHLGVPFTCIGQMTADIEGLCFIRDGEPVTLDWKGYDHFATP"
     MACGEFSLIA RYFDRVRSSR LDVELGIGDD CALLNIPEKQ TLAISTDTLV AGNHFLPDID        60
     PADLAYKALA VNLSDLAAMG ADPAWLTLAL TLPDVDEAWL ESFSDSLFDL LNYYDMQLIG       120
     GDTTRGPLSM TLGIHGFVPM GRALTRSGAK PGDWIYVTGT PGDSAAGLAI LQNRLQVADA       180
     KDADYLIKRH LRPSPRILQG QALRDLANSA IDLSDGLISD LGHIVKASDC GARIDLALLP       240
     FSDALSRHVE PEQALRWALS GGEDYELCFT VPELNRGALD VALGHLGVPF TCIGQMTADI       300
     EGLCFIRDGE PVTLDWKGYD HFATP                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page