(data stored in ACNUC7421 zone)

EMBL: CP001509.THRB

CP001509.THRB        Location/Qualifiers
FT   CDS             2800..3732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="ECD_00003"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="similar to b0003"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00003"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41905"
FT                   /protein_id="ACT41905.1"
FT                   /translation="MVKVYAPASSANMSVGFDVLGAAVTPVDGALLGDVVTVEAAETFS
FT                   LNNLGRFADKLPSEPRENIVYQCWERFCQELGKQIPVAMTLEKNMPIGSGLGSSACSVV
FT                   AALMAMNEHCGKPLNDTRLLALMGELEGRISGSIHYDNVAPCFLGGMQLMIEENDIISQ
FT                   QVPGFDEWLWVLAYPGIKVSTAEARAILPAQYRRQDCIAHGRHLAGFIHACYSRQPELA
FT                   AKLMKDVIAEPYRERLLPGFRQARQAVAEIGAVASGISGSGPTLFALCDKPDTAQRVAD
FT                   WLGKNYLQNQEGFVHICRLDTAGARVLEN"
     MVKVYAPASS ANMSVGFDVL GAAVTPVDGA LLGDVVTVEA AETFSLNNLG RFADKLPSEP        60
     RENIVYQCWE RFCQELGKQI PVAMTLEKNM PIGSGLGSSA CSVVAALMAM NEHCGKPLND       120
     TRLLALMGEL EGRISGSIHY DNVAPCFLGG MQLMIEENDI ISQQVPGFDE WLWVLAYPGI       180
     KVSTAEARAI LPAQYRRQDC IAHGRHLAGF IHACYSRQPE LAAKLMKDVI AEPYRERLLP       240
     GFRQARQAVA EIGAVASGIS GSGPTLFALC DKPDTAQRVA DWLGKNYLQN QEGFVHICRL       300
     DTAGARVLEN                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page