(data stored in ACNUC7421 zone)

EMBL: CP001509.TOLA

CP001509.TOLA        Location/Qualifiers
FT   CDS             735003..736268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolA"
FT                   /locus_tag="ECD_00699"
FT                   /product="membrane anchored protein in TolA-TolQ-TolR
FT                   complex"
FT                   /note="similar to b0739"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00699"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42574"
FT                   /protein_id="ACT42574.1"
FT                   /translation="MSKATEQNDKLKRAIIISAVLHVILFAALIWSSFDENIEASAGGG
FT                   GGSSIDAVMVDSGAVVEQYKRMQSQESSAKRSDEQRKMKEQQAAEELREKQAAEQERLK
FT                   QLEKERLAAQEQKKQAEEAAKQAELKQKQAEEAAAKAAADAKAKAEADAKAAEEAAKKA
FT                   AADAKKKAEAEAAKAAAEAQKKAEAAAAALKKKAEAAEAAAAEARKKAATEAAEKAKAE
FT                   AEKKAAAEKAAADKKAAAEKAAADKKAAEKAAAEKAAADKKAAAEKAAADKKAAAAKAA
FT                   AEKAAAAKAAAEADDIFGELSSGKNAPKTGGGAKGNNASPAGSGNTKNNGASGADINNY
FT                   AGQIKSAIESKFYDASSYAGKTCTLRIKLAPDGMLLDIKPEGGDPALCQAALAAAKLAK
FT                   IPKPPSQAVYEVFKNAPLDFKP"
     MSKATEQNDK LKRAIIISAV LHVILFAALI WSSFDENIEA SAGGGGGSSI DAVMVDSGAV        60
     VEQYKRMQSQ ESSAKRSDEQ RKMKEQQAAE ELREKQAAEQ ERLKQLEKER LAAQEQKKQA       120
     EEAAKQAELK QKQAEEAAAK AAADAKAKAE ADAKAAEEAA KKAAADAKKK AEAEAAKAAA       180
     EAQKKAEAAA AALKKKAEAA EAAAAEARKK AATEAAEKAK AEAEKKAAAE KAAADKKAAA       240
     EKAAADKKAA EKAAAEKAAA DKKAAAEKAA ADKKAAAAKA AAEKAAAAKA AAEADDIFGE       300
     LSSGKNAPKT GGGAKGNNAS PAGSGNTKNN GASGADINNY AGQIKSAIES KFYDASSYAG       360
     KTCTLRIKLA PDGMLLDIKP EGGDPALCQA ALAAAKLAKI PKPPSQAVYE VFKNAPLDFK       420
     P                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page