(data stored in ACNUC7421 zone)

EMBL: CP001509.TOLQ

CP001509.TOLQ        Location/Qualifiers
FT   CDS             733814..734506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolQ"
FT                   /locus_tag="ECD_00697"
FT                   /product="membrane spanning protein in TolA-TolQ-TolR
FT                   complex"
FT                   /note="similar to b0737"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00697"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42572"
FT                   /protein_id="ACT42572.1"
FT                   /translation="MTDMNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAA
FT                   AREAEAFEDKFWSGIELSRLYQESQGKRDNLTGSEQIFYSGFKEFVRLHRANSHAPEAV
FT                   VEGASRAMRISMNRELENLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQAT
FT                   LQMVAPGIAEALIATAIGLFAAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQAF
FT                   TVSESNKG"
     MTDMNILDLF LKASLLVKLI MLILIGFSIA SWAIIIQRTR ILNAAAREAE AFEDKFWSGI        60
     ELSRLYQESQ GKRDNLTGSE QIFYSGFKEF VRLHRANSHA PEAVVEGASR AMRISMNREL       120
     ENLETHIPFL GTVGSISPYI GLFGTVWGIM HAFIALGAVK QATLQMVAPG IAEALIATAI       180
     GLFAAIPAVM AYNRLNQRVN KLELNYDNFM EEFTAILHRQ AFTVSESNKG                  230
//

If you have problems or comments...

PBIL Back to PBIL home page