(data stored in ACNUC7421 zone)

EMBL: CP001509.TOLR

CP001509.TOLR        Location/Qualifiers
FT   CDS             734510..734938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolR"
FT                   /locus_tag="ECD_00698"
FT                   /product="membrane spanning protein in TolA-TolQ-TolR
FT                   complex"
FT                   /note="similar to b0738"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00698"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42573"
FT                   /protein_id="ACT42573.1"
FT                   /translation="MARARGRGRRDLKSEINIVPLLDVLLVLLLIFMATAPIITQSVEV
FT                   DLPDATESQAVSSNDNPPVIVEVSGIGQYTVVVKKDRLERLPPEQVVAEVSSRFKANPK
FT                   TVFLIGGAKDVPYDEIIKALNLLHSAGVKSVGLMTQPI"
     MARARGRGRR DLKSEINIVP LLDVLLVLLL IFMATAPIIT QSVEVDLPDA TESQAVSSND        60
     NPPVIVEVSG IGQYTVVVKK DRLERLPPEQ VVAEVSSRFK ANPKTVFLIG GAKDVPYDEI       120
     IKALNLLHSA GVKSVGLMTQ PI                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page