(data stored in ACNUC7421 zone)

EMBL: CP001509.W

CP001509.W           Location/Qualifiers
FT   CDS             771107..771313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="W"
FT                   /locus_tag="ECD_10037"
FT                   /product="head-tail joining protein"
FT                   /note="similar to lambdap03"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10037"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42619"
FT                   /protein_id="ACT42619.1"
FT                   /translation="MTRQEELAAARAALHDLMTGKRVATVQKDGRRVEFTATSVSDLKK
FT                   YIAELEVQTGMTQRRRGPAGFYV"
     MTRQEELAAA RAALHDLMTG KRVATVQKDG RRVEFTATSV SDLKKYIAEL EVQTGMTQRR        60
     RGPAGFYV                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page