(data stored in ACNUC7421 zone)

EMBL: CP001509.XSEB

CP001509.XSEB        Location/Qualifiers
FT   CDS             complement(406502..406744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="ECD_00370"
FT                   /product="exonuclease VII small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="similar to b0422"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00370"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42269"
FT                   /protein_id="ACT42269.1"
FT                   /translation="MPKKNEAPASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQL
FT                   ARQGQAKLQQAEQRVQILLSDNEDASLTPFTPDNE"
     MPKKNEAPAS FEKALSELEQ IVTRLESGDL PLEEALNEFE RGVQLARQGQ AKLQQAEQRV        60
     QILLSDNEDA SLTPFTPDNE                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page