(data stored in ACNUC7421 zone)

EMBL: CP001509.YAAI

CP001509.YAAI        Location/Qualifiers
FT   CDS             complement(11380..11784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaI"
FT                   /locus_tag="ECD_00013"
FT                   /product="UPF0412 family protein"
FT                   /note="similar to b0013"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00013"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41915"
FT                   /protein_id="ACT41915.1"
FT                   /translation="MKSVFTISASLAISLMLCCTAQANDHKLLGVIAMPRNETNDLALK
FT                   LPVCRIVKRIQLSADHGDLQLSGASVYFKAARSASQSLNIPSEIKEGQTTDWININSDN
FT                   DNKRCVSKITFSGHTVNSSDMATLKIIGDD"
     MKSVFTISAS LAISLMLCCT AQANDHKLLG VIAMPRNETN DLALKLPVCR IVKRIQLSAD        60
     HGDLQLSGAS VYFKAARSAS QSLNIPSEIK EGQTTDWINI NSDNDNKRCV SKITFSGHTV       120
     NSSDMATLKI IGDD                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page