(data stored in ACNUC7421 zone)

EMBL: CP001509.YAAU

CP001509.YAAU        Location/Qualifiers
FT   CDS             50003..51334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaU"
FT                   /locus_tag="ECD_00049"
FT                   /product="putative MFS sugar transporter; membrane protein"
FT                   /note="similar to b0045"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00049"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41950"
FT                   /protein_id="ACT41950.1"
FT                   /translation="MQPSRNFDDLKFSSIHRRILLWGSGGPFLDGYVLVMIGVALEQLT
FT                   PALKLDADWIGLLGAGTLAGLFVGTSLFGYISDKVGRRKMFLIDIIAIGVISVATMFVS
FT                   SPVELLVMRVLIGIVIGADYPIATSMITEFSSTRQRAFSISFIAAMWYVGATCADLVGY
FT                   WLYDVEGGWRWMLGSAAIPCLLILIGRFELPESPRWLLRKGRVKECEEMMIKLFGEPVA
FT                   FDEEQPQQTRFRDLFNRRHFPFVLFVAAIWTCQVIPMFAIYTFGPQIVGLLGLGVGKNA
FT                   ALGNVVISLFFMLGCIPPMLWLNTAGRRPLLIGSFAMMTLALAVLGLIPDMGIWLVVMA
FT                   FAVYAFFSGGPGNLQWLYPNELFPTDIRASAVGVIMSLSRIGTIVSTWALPIFINNYGI
FT                   SNTMLMGAGISLFGLLISVAFAPETRGMSLAQTSNMTIRGQRMG"
     MQPSRNFDDL KFSSIHRRIL LWGSGGPFLD GYVLVMIGVA LEQLTPALKL DADWIGLLGA        60
     GTLAGLFVGT SLFGYISDKV GRRKMFLIDI IAIGVISVAT MFVSSPVELL VMRVLIGIVI       120
     GADYPIATSM ITEFSSTRQR AFSISFIAAM WYVGATCADL VGYWLYDVEG GWRWMLGSAA       180
     IPCLLILIGR FELPESPRWL LRKGRVKECE EMMIKLFGEP VAFDEEQPQQ TRFRDLFNRR       240
     HFPFVLFVAA IWTCQVIPMF AIYTFGPQIV GLLGLGVGKN AALGNVVISL FFMLGCIPPM       300
     LWLNTAGRRP LLIGSFAMMT LALAVLGLIP DMGIWLVVMA FAVYAFFSGG PGNLQWLYPN       360
     ELFPTDIRAS AVGVIMSLSR IGTIVSTWAL PIFINNYGIS NTMLMGAGIS LFGLLISVAF       420
     APETRGMSLA QTSNMTIRGQ RMG                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page