(data stored in ACNUC7421 zone)

EMBL: CP001509.YAAW

CP001509.YAAW        Location/Qualifiers
FT   CDS             complement(10641..11354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaW"
FT                   /locus_tag="ECD_00011"
FT                   /product="UPF0174 family protein"
FT                   /note="similar to b0011"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00011"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41913"
FT                   /protein_id="ACT41913.1"
FT                   /translation="MNVNYLNDSDLDFLQHCSEEQLANFARLLTHNEKGKTRLSSVLIR
FT                   NELFKSMEGHPEQHRRNWQLIAGELQHFGGDSIANKLRGHGKLYRAILLDVSKRLKLKA
FT                   DKEMSTFEIEQQLLEQFLRNTWKNMDEEHKQEFLHAVDARVNELEELLPLLMKDKLLAK
FT                   GVSHLLSSQLTRILRTHAAMSVLGHGLLRGAGLGGPVGAALNGVKAVSGSAYRVTIPAV
FT                   LQIACLRRMVSATQV"
     MNVNYLNDSD LDFLQHCSEE QLANFARLLT HNEKGKTRLS SVLIRNELFK SMEGHPEQHR        60
     RNWQLIAGEL QHFGGDSIAN KLRGHGKLYR AILLDVSKRL KLKADKEMST FEIEQQLLEQ       120
     FLRNTWKNMD EEHKQEFLHA VDARVNELEE LLPLLMKDKL LAKGVSHLLS SQLTRILRTH       180
     AAMSVLGHGL LRGAGLGGPV GAALNGVKAV SGSAYRVTIP AVLQIACLRR MVSATQV          237
//

If you have problems or comments...

PBIL Back to PBIL home page