(data stored in ACNUC7421 zone)

EMBL: CP001509.YAAX

CP001509.YAAX        Location/Qualifiers
FT   CDS             5232..5528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaX"
FT                   /locus_tag="ECD_00005"
FT                   /product="DUF2502 family putative periplasmic protein"
FT                   /note="similar to b0005"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00005"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41907"
FT                   /protein_id="ACT41907.1"
FT                   /translation="MKKMQSIVLALSLVLVAPMAAQAAEITLVPSVKLQIGDRDNRGYY
FT                   WDGGHWRDHGWWKQHYEWRGNRWHPHGPPPPPRHHKKAPHDHHGGHGPGKHHR"
     MKKMQSIVLA LSLVLVAPMA AQAAEITLVP SVKLQIGDRD NRGYYWDGGH WRDHGWWKQH        60
     YEWRGNRWHP HGPPPPPRHH KKAPHDHHGG HGPGKHHR                                98
//

If you have problems or comments...

PBIL Back to PBIL home page